PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G07380.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 897aa    MW: 96963 Da    PI: 6.5042
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G07380.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.8e-191270357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     k  ++t+eq+e+Le+l++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  OGLUM01G07380.3 12 KYVRYTPEQVEALERLYYECPKPSSLRRQQLVRECpalaNVDPKQIKVWFQNRRCREKQ 70
                     6789*****************************************************97 PP

2START150.31.7e-471794112204
                      HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT....... CS
            START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg....... 88 
                      +aee+++e+++ka+ ++  W +++ +++g++++ +++ s+++ g a+ra+g+v m++a  v+e+l+d++ W ++++++++++v+  g       
  OGLUM01G07380.3 179 IAEETLTEFLSKATGTAVEWLQMPGMKPGPDSIGIIAISHGCAGVAARACGLVGMEPA-KVAEILKDRPLWLRDCRSMDVVNVLPAGangtiel 271
                      789*******************************************************.8888888888************************* PP

                      .................EEEEEEE...EXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEEC CS
            START  89 .................galqlmv...aelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepks 158
                                       ++l l +    +l+a+++l+p Rdf+ +Ry+  l +g++v++++S++s+q  p+    ++++R+e+lpSg+li+p++
  OGLUM01G07380.3 272 lymqarthkpensepepEILKLKFvfdLQLYAPTTLAPaRDFWLLRYTSILDDGSLVVCERSLSSKQGGPSmplVQPFIRGEMLPSGFLIRPSD 365
                      *****************555555422269999**************************************999999****************** PP

                      TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      +g+s +++v+h+dl+ +++++++r+l++s+++ ++k+ +a+l++++
  OGLUM01G07380.3 366 GGGSVIHIVDHMDLEPWSVPEVVRPLYESSAMVAQKISMAALRYLR 411
                      ******************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.532771IPR001356Homeobox domain
SMARTSM003896.9E-15975IPR001356Homeobox domain
CDDcd000864.16E-161272No hitNo description
PfamPF000462.4E-161270IPR001356Homeobox domain
SuperFamilySSF466898.98E-171373IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-181470IPR009057Homeodomain-like
CDDcd146864.45E-664103No hitNo description
PROSITE profilePS5084823.77169413IPR002913START domain
SuperFamilySSF559617.69E-32170266No hitNo description
CDDcd088757.24E-68173412No hitNo description
Gene3DG3DSA:3.30.530.202.5E-17176388IPR023393START-like domain
SMARTSM002342.6E-34178413IPR002913START domain
PfamPF018521.2E-16179275IPR002913START domain
SuperFamilySSF559617.69E-32296392No hitNo description
PfamPF018522.5E-27300411IPR002913START domain
PfamPF086703.9E-48748896IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MVASAAAMDA SKYVRYTPEQ VEALERLYYE CPKPSSLRRQ QLVRECPALA NVDPKQIKVW  60
FQNRRCREKQ RKESSRLQAL NRKLTAMNKL LMEENDRLQK QVSQLVYDHG RHGVAAAGRM  120
RRVPAFPPQA AAPAGHQLAT ATDTSCESVV TSGHHHQQQQ HNVVQPPPRD ASPAGLMSIA  180
EETLTEFLSK ATGTAVEWLQ MPGMKPGPDS IGIIAISHGC AGVAARACGL VGMEPAKVAE  240
ILKDRPLWLR DCRSMDVVNV LPAGANGTIE LLYMQARTHK PENSEPEPEI LKLKFVFDLQ  300
LYAPTTLAPA RDFWLLRYTS ILDDGSLVVC ERSLSSKQGG PSMPLVQPFI RGEMLPSGFL  360
IRPSDGGGSV IHIVDHMDLE PWSVPEVVRP LYESSAMVAQ KISMAALRYL RQVAHEDTRS  420
VITGWGRQPA ALRALSQKLT RGFNETLNGL ADDGWSVIES DGVDDVCISV NSSKVIGCNA  480
TFSSGLPIVS TGVLCAKASM LLQDVSPPSL LQFLREHRSQ WADSNLDAFF ASAMKPNFCN  540
LPMSRLGGFS GQVILPLAHT FEPEEFLEVI KLGNASNYQD TLVHRDLFLL QMYNGVEESS  600
AGTCSELIFA PIDASFSDDS PLLPSGFRII PIDSPLDTSS PNCTLDLAST LEAATPRSRI  660
SGVNGGGGGG CAAAAASSKA VMTIAFQFAF DGHLQDSVAA MARQYMRSII SSVQRIAVAL  720
SSSRLVPPAG AGGGAAPQLA PANPEAATLP RWICQSFRFH FGAELIKSVD ANSSSESILK  780
AVWHHPSAIL CCSLKAMPVF TFANQSGLDM LETTLVALQD MTLEKVFDDQ GRKNLCTELP  840
NIMEQGMACM EGGVCVSSVG RAASYEKAVA WKVVDGDGGG GGGAHCICFM FINWTFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3742070.0AB374207.1 Oryza sativa Japonica Group OSHB5 mRNA for class III homeodomain-leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624690.10.0PREDICTED: homeobox-leucine zipper protein HOX29
SwissprotA2WLR50.0HOX29_ORYSI; Homeobox-leucine zipper protein HOX29
TrEMBLA0A0D9Y4V40.0A0A0D9Y4V4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA002186-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.10.0HD-ZIP family protein